PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006990m
Common NameCARUB_v10006990mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 141aa    MW: 15809.2 Da    PI: 10.4917
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006990mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.8e-153883147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r+rWT+ Ed++l+++v+  G+ +Wk I  +m  g+t+k+c+ rw  y
  Carubv10006990m 38 RKRWTPSEDLQLKELVAVSGPQNWKQIGDKML-GKTGKSCRMRWVGY 83
                     89*****************************9.***********766 PP

2Myb_DNA-binding49.21.2e-1590135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++++T eEd +l+ + k++G++ W++Ia+ +  gRt+  +k++w+k++
  Carubv10006990m  90 KKAFTDEEDAILLACQKKMGNK-WSKIAKILS-GRTDTAVKNHWHKLM 135
                      679*******************.*********.*************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1733384IPR017930Myb domain
SuperFamilySSF466892.68E-2736131IPR009057Homeodomain-like
SMARTSM007177.5E-133786IPR001005SANT/Myb domain
PfamPF002492.6E-133884IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-224091IPR009057Homeodomain-like
CDDcd001678.25E-114084No hitNo description
PROSITE profilePS5129425.96285139IPR017930Myb domain
SMARTSM007171.5E-1489137IPR001005SANT/Myb domain
PfamPF002499.0E-1390134IPR001005SANT/Myb domain
CDDcd001672.23E-1092135No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2092137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
TQVSQHILFD VALQGPASNG SGENDALMGV THEKKKERKR WTPSEDLQLK ELVAVSGPQN  60
WKQIGDKMLG KTGKSCRMRW VGYLDPNINK KAFTDEEDAI LLACQKKMGN KWSKIAKILS  120
GRTDTAVKNH WHKLMNRGKH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-28411377103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285549.11e-101hypothetical protein CARUB_v10006990mg, partial
TrEMBLR0F9311e-101R0F931_9BRAS; Uncharacterized protein (Fragment)
STRINGAT5G39700.16e-46(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39700.11e-49myb domain protein 89